PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo19G0027900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 229aa    MW: 25910.3 Da    PI: 8.2914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo19G0027900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-151360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ede+l++++  +G g+W++ ++  g+ R++k+c++rw +yl
  Spipo19G0027900 13 KGAWSKQEDEKLINYIYSYGEGCWRSLPKAAGLLRCGKSCRLRWINYL 60
                     79******************************99************97 PP

2Myb_DNA-binding52.41.2e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Spipo19G0027900  66 RGKFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-23463IPR009057Homeodomain-like
PROSITE profilePS5129415.789860IPR017930Myb domain
SuperFamilySSF466891.3E-2711107IPR009057Homeodomain-like
SMARTSM007172.6E-121262IPR001005SANT/Myb domain
PfamPF002495.8E-141360IPR001005SANT/Myb domain
CDDcd001672.86E-91560No hitNo description
PROSITE profilePS5129426.50161115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2564115IPR009057Homeodomain-like
SMARTSM007171.4E-1565113IPR001005SANT/Myb domain
PfamPF002492.2E-1566111IPR001005SANT/Myb domain
CDDcd001671.16E-1068111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MRKPCCEDQH INKGAWSKQE DEKLINYIYS YGEGCWRSLP KAAGLLRCGK SCRLRWINYL  60
RPDLKRGKFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRKRVTEMGV  120
DWRNSRQTDK SPFHSSKWSQ SSGVKLSPST MSLHRCNGCT PSSNHSHAGE VWISDEASSV  180
EDDSPLLPDL NLDLNLSSTF PFHGLAGQTL REMKEVGDGL PPTLLQFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274638.12e-86PREDICTED: transcription repressor MYB6-like
RefseqXP_010916352.12e-86PREDICTED: myb-related protein 308-like
SwissprotP813932e-74MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A059D6I42e-83A0A059D6I4_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s12420.15e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.12e-71myb domain protein 6